PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco017499.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MIKC_MADS
Protein Properties Length: 202aa    MW: 23368.7 Da    PI: 9.1528
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco017499.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.34.6e-294291251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 rien+  rqvtfskRrng+lKKA+ELSvLCdaeva++ifs+ gklye++s
  Aco017499.1 42 RIENTASRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSTAGKLYEFAS 91
                 8***********************************************86 PP

2K-box57.65.6e-20114202997
        K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                  ++++   + + e+a L k+ie  ++e+R+l G ++es+sl+eL+ Le +Le+sl+kiRskK++ +l++i+el++ke  l +en  Lr+k
  Aco017499.1 114 AAQQSLVQRRSEAATLAKKIELHETEKRKLCGGGVESCSLEELHDLEAELERSLSKIRSKKQRKILQEISELKEKESLLLKENALLREK 202
                  34444555678***************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-313392IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.9593393IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-273555IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003589IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-3035112IPR002100Transcription factor, MADS-box
CDDcd002652.36E-3542108No hitNo description
PfamPF003193.6E-264289IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-275570IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-277091IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.454119202IPR002487Transcription factor, K-box
PfamPF014862.2E-20121202IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MPFLVSPLPY KEREHLVERE REHLVERERE RERERGKGGF DRIENTASRQ VTFSKRRNGL  60
LKKAFELSVL CDAEVALVIF STAGKLYEFA SSNMQKTIDR YTSHTKEDIG SKEAAQQSLV  120
QRRSEAATLA KKIELHETEK RKLCGGGVES CSLEELHDLE AELERSLSKI RSKKQRKILQ  180
EISELKEKES LLLKENALLR EK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A3e-2035104271Myocyte-specific enhancer factor 2A
3mu6_B3e-2035104271Myocyte-specific enhancer factor 2A
3mu6_C3e-2035104271Myocyte-specific enhancer factor 2A
3mu6_D3e-2035104271Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008783455.12e-62PREDICTED: MADS-box transcription factor 50-like
SwissprotQ9XJ602e-61MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLW1NL132e-61W1NL13_AMBTC; Uncharacterized protein
STRINGBra039324.1-P3e-59(Brassica rapa)
STRINGORGLA03G0015400.14e-59(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.14e-49AGAMOUS-like 20